<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28947

Description Transducin beta like 1 X-linked
SequenceMSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFRDKLAQQQAACTTAASTSGNQPNAPKNGEATVNGEENGTHAMNNHREPMETDVDIEIPASKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENTNSNSTQLVLRHCIREGGQDVPSNKDVTSLDWNSDGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNSILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGSDRPLKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDSCVHDLQAHSKEIYTIKWSPTGPSTNNPNSNIMLASASFDSTVRLWDVERGVCIHTLTKHREPVYSVAFSPDGKHLASGSFDKCVHIWNTMTGALVHSYRGTGGIFEVCWNSTGDKVGASASDGSVCVLDLRK
Length513
PositionTail
OrganismOryzias latipes (Japanese rice fish) (Japanese killifish)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae> Oryzias.
Aromaticity0.07
Grand average of hydropathy-0.342
Instability index37.18
Isoelectric point5.47
Molecular weight55855.63
Publications
PubMed=17554307

Function

Annotated function 
GO - Cellular Component
histone deacetylase complex	GO:0000118	IBA:GO_Central

GO - Biological Function
transcription corepressor activity	GO:0003714	IBA:GO_Central

GO - Biological Process
histone deacetylation	GO:0016575	IBA:GO_Central
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28947
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             8|     358.88|      40|      40|     321|     360|       1
---------------------------------------------------------------------------
  164-  197 (38.86/17.77)	..LRGHESEVFICAWNPVS.........dlLASGS.GD...........STARIWNL......
  223-  257 (39.70/18.31)	.S....NKDVTSLDWNSDG.........tlLATGS.YD...........GFARI.W.TKDGNL
  259-  300 (50.94/25.42)	STLGQHKGPIFALKWNKKG.........nsILSAG.VD...........KTTIIWDAHTGEAK
  301-  341 (56.26/28.78)	QQFPFHSAPALDVDWQNN..........ttFASCS.TD...........MCIHVCRLGSDRPL
  342-  383 (62.01/32.42)	KTFQGHTNEVNAIKWDPSG.........mlLASCS.DD...........MTLKIWSMKQDSCV
  384-  435 (28.33/11.11)	HDLQAHSKEIYTIKWSPTGpstnnpnsnimLASAS.FDstvrlwdvergVCIH..........
  436-  476 (54.71/27.80)	.TLTKHREPVYSVAFSPDG.........khLASGS.FD...........KCVHIWNTMTGALV
  477-  508 (28.09/10.96)	HSYRG.TGGIFEVCWNSTG........dkvGASASdGS...........VCV...........
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28947 with Med16 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) ACTTAASTSGNQPNAPKNGEATVNGEENGTHAMNNHREPMETDVDIEIPASK
109
160










Molecular Recognition Features






MoRF SequenceStartStop




NANANA