<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28943
Description |
Cyclin C |
Sequence | MAGNFWQSSHYLQWVLDKQDLIKERQKDLKFLSEEEYWKLQIFFANVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMDKVRFLPYFDVRVARLALNGYIYIDHYLTLQVRAASLQNVCPKAILLSQKCSTSCQ |
Length | 280 |
Position | Kinase |
Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
Aromaticity | 0.14 |
Grand average of hydropathy | 0.098 |
Instability index | 45.83 |
Isoelectric point | 8.25 |
Molecular weight | 32828.10 |
Publications | PubMed=17554307
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP28943
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.96| 11| 23| 5| 17| 1
---------------------------------------------------------------------------
5- 17 (19.07/15.45) FWQSSHYlqWVLD
31- 41 (20.89/10.48) FLSEEEY..WKLQ
---------------------------------------------------------------------------
|