<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28942
| Description |
"Transcription elongation factor A (SII), 2" |
| Sequence | MCRMKLQRPDSSTNDANCHTDEGALDLLKELQNIKMSLETLQSTRVGMSVNAVRKQSSDEEVQTLAKSLIKSWKRLLDGSEGKSEKKEKKKEGSPLRSSSTSSDSGSSGKSAKSGDTPTTPNTPSTPTLPPLITSFPPAPVTSDSVRNKCRELLVAALQTDDDYKTIGVDCDHLAAQIEHQIFQEFKSTDMKYKARLRSRISNLKDQKNPDLRRNVLCGNISAQRIACMTAEEMASAELKQIREALTKESIREHQLSKVGGTETDMFICSKCHGKNCTYTQVQTRSADEPMTTFVLCNGCGNRWKFC |
| Length | 307 |
| Position | Unknown |
| Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.716 |
| Instability index | 55.38 |
| Isoelectric point | 8.75 |
| Molecular weight | 34005.19 |
| Publications | PubMed=17554307
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28942
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.96| 22| 228| 53| 74| 1
---------------------------------------------------------------------------
53- 74 (36.77/25.26) VRKQSSDEEVQT..LAKSLIKSWK
282- 305 (38.19/26.51) VQTRSADEPMTTfvLCNGCGNRWK
---------------------------------------------------------------------------
|