<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28938
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MAEKFDNLEEHLEKFVENIRQLGIIVSDFQPSSQAVLNQKLNFMISGLQDIEKCRQQLHEINVPLEVFDYIDQGRNPQLYTKECLERALARNEQVKGKIDTMMKFKSLLISELSKVFPEEMAKYKAIHGEDAPP |
Length | 134 |
Position | Middle |
Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.475 |
Instability index | 48.01 |
Isoelectric point | 5.25 |
Molecular weight | 15539.70 |
Publications | PubMed=17554307
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | atrioventricular canal development GO:0036302 IEA:Ensembl
cardiac jelly development GO:1905072 IEA:Ensembl
positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP28938
No repeats found
No repeats found
|