<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28936
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAAAAEKSTKERLLSVLDDLEVLSRELIEMLALARNQKVPQPGEDTQILELLVQRDKEFQELMEVAQQQGKIHQEMQLLEKEVEKRDSDIQQLQKQLKEAEHILATAVYQAKEKLASIEKAKKGSVSSEEIIKYAHRISASNAVCAPLNWVPGDPRRPYPTDLEMRSGILGHMANLPSNGVNGHLPGDALAAGRLPDILTPHYPWQSSDVSAGMLPPHHGNDFSLEPPGHNKENEDDVEAMSTDSSSSSSDSD |
Length | 253 |
Position | Middle |
Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.619 |
Instability index | 54.12 |
Isoelectric point | 4.98 |
Molecular weight | 27927.01 |
Publications | PubMed=17554307
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP28936
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.77| 27| 28| 47| 74| 1
---------------------------------------------------------------------------
20- 41 (29.32/21.58) ..LEVL....SRELIEMLALARNQ.KVPQ
47- 74 (42.65/41.41) QILELLV.QRDKEFQELMEVAQQQgKIHQ
77- 96 (20.79/12.71) QLLEKEVeKRDSDIQQL....QKQ.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.25| 13| 17| 186| 202| 2
---------------------------------------------------------------------------
186- 202 (21.09/20.44) P..GDALAAGRLPdiltPH
204- 218 (22.16/12.04) PwqSSDVSAGMLP....PH
---------------------------------------------------------------------------
|