<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28923
| Description |
Uncharacterized protein |
| Sequence | MASSISGMFPGQQLTGSHPVGGPGAPGQPGFPMGAARAQGNNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVVKEDVSELRNELQRKEQLVQKHLAKLHHWQQVLEDVSGQHRKPTDLPPPGPLAFLEQASANLPPAPLKPN |
| Length | 180 |
| Position | Head |
| Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.513 |
| Instability index | 46.23 |
| Isoelectric point | 5.51 |
| Molecular weight | 19717.03 |
| Publications | PubMed=17554307
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28923
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.16| 15| 15| 105| 119| 1
---------------------------------------------------------------------------
105- 119 (24.30/15.80) QKPEQVVKEDVSELR
123- 137 (24.86/16.31) QRKEQLVQKHLAKLH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.80| 15| 22| 41| 62| 3
---------------------------------------------------------------------------
41- 55 (25.01/27.34) NNTLVDELEASFEAC
66- 80 (26.79/12.09) NGTDQEEIRTGVDQC
---------------------------------------------------------------------------
|