<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28921
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MGEPQQVSALPPPPMQYIKEYTDENIRKGLVPKPPPPIRDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKRELKKLNMSILVNFLDLLDILIKSPGNIKREEKMEDIKLLFVHMHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVVEMIQGCLASAPDDLLCMVAGNQEKNIPSSKRDKIWDKDAAMCSIIDELA |
Length | 210 |
Position | Middle |
Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.531 |
Instability index | 51.11 |
Isoelectric point | 6.39 |
Molecular weight | 24554.42 |
Publications | PubMed=17554307
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP28921
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.69| 12| 26| 11| 30| 1
---------------------------------------------------------------------------
11- 22 (26.29/ 7.00) PPPP.....MQYIKEYT
34- 50 (21.40/14.47) PPPPirdsyMMFGNQFQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.01| 16| 26| 75| 92| 2
---------------------------------------------------------------------------
75- 92 (21.27/22.52) KRELKKLNMSILvnFLDL
104- 119 (27.74/20.75) KREEKMEDIKLL..FVHM
---------------------------------------------------------------------------
|