<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28920
Description |
Uncharacterized protein |
Sequence | MTPELFCQHRKRSKMASQQQQQQQAGGPMSQPGLQQPASIQQQQQQQLSQQQDFDPVHRFKMLIPQLKESLQNLMKIASMNLSYNTSIDNGIKSSDTSVQRFDKSLEEFYALCDQLELCLRLAYECLSQSIDSAKHSPNLVPTATKPDTVQTESMSYAQYLTMIKSQISCAKDIHNALLECSKKIAGKGPPQGMIAGR |
Length | 198 |
Position | Tail |
Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.618 |
Instability index | 72.92 |
Isoelectric point | 8.50 |
Molecular weight | 22211.12 |
Publications | PubMed=17554307
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | eye photoreceptor cell development GO:0042462 IEA:Ensembl
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP28920
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.99| 14| 21| 17| 37| 1
---------------------------------------------------------------------------
17- 37 (19.81/21.99) S.QQQQQQQaggpMSQpglQQ...P
39- 56 (20.18/ 6.06) SiQQQQQQQ....LSQ...QQdfdP
---------------------------------------------------------------------------
|