<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28917

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMTEMFSTLFGQNEAQGPPGSSSLGFGPGKPPPPMPQNQVPMAGQMTPQLGDDGPTLRKTGAMNEPFYLLRELPVGNELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDSPGTQDGSSLRSLIDKPPVCGNSFSPLTGTMLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHKHHRPQDPLPQETPSDTDPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPDHPGLAGSQPNSNSLR
Length244
PositionHead
OrganismOryzias latipes (Japanese rice fish) (Japanese killifish)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae> Oryzias.
Aromaticity0.05
Grand average of hydropathy-1.144
Instability index49.57
Isoelectric point9.80
Molecular weight27103.67
Publications
PubMed=17554307

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
transcription factor binding	GO:0008134	IBA:GO_Central

GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28917
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      68.01|      13|      17|     200|     212|       1
---------------------------------------------------------------------------
  179-  190 (19.51/ 6.27)	.KHKHHRPQDPLP
  200-  212 (25.06/ 9.70)	KKKKKKRDDDPDR
  219-  230 (23.43/ 8.70)	KKKKKNR.HSPDH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     187.08|      45|      69|      28|      80|       2
---------------------------------------------------------------------------
   28-   72 (84.39/27.98)	GKPPPPMPQNQV.P.MAGQMTPQLGDDGPTLRKTGAMNEPFYLLREL
   99-  130 (37.50/12.56)	GKKVKEKLSNFL.PeLPGMIDSPGTQDGSSLRS..............
  133-  170 (65.20/19.58)	DK..PPVCGNSFsP.LTGTML.....TGFRL.HTGPLPEQYRLMHIQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28917 with Med19 domain of Kingdom Metazoa
Unable to open file!