<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28909
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MVQQLSLFGAIDDDSYSLFVSTITTLSGNPPILFARLSTIWKPNPEYEINNTNSKNQLVEKARINVSKTLSLNSFNLPESEIMDYNLLKTLPNDENTGIIDSSRINEILQSKDLSAWSFAISDIPASASSNNRKVSVQNISETVLLSSTGSSSNLTHFMNELAYVSEFKYVTIGIKFNLKHNLIIELQKIWNVNDENSNTQITKGGFLIKAFINVAKATDVDKINHNESVLLNLQKELQGYVNLSIPDRSSMDSRMAYDI |
| Length | 260 |
| Position | Head |
| Organism | Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-8276) (Yeast) (Kluyveromyces africanus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kazachstania.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.226 |
| Instability index | 35.64 |
| Isoelectric point | 5.15 |
| Molecular weight | 29075.46 |
| Publications | PubMed=22123960
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
termination of RNA polymerase II transcription GO:0006369 IEA:EnsemblFungi
transcription open complex formation at RNA polymerase II promoter GO:0001113 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP28909
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.76| 12| 99| 75| 96| 1
---------------------------------------------------------------------------
45- 56 (23.32/ 7.08) PEYEINN.....T..NSKN
78- 96 (12.44/16.83) PESEIMDynllkTlpNDEN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.99| 18| 43| 58| 75| 2
---------------------------------------------------------------------------
58- 75 (30.13/19.45) LVEKARIN...VSKTLSLNSF
99- 119 (27.86/17.48) IIDSSRINeilQSKDLSAWSF
---------------------------------------------------------------------------
|