<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28906

Description Mediator of RNA polymerase II transcription subunit 7
SequenceMSENTANDISSLYPSPPPYIRFFTEKNLAKLAEYKEQKETEKNDNDHDGEIEEEEVTNSELDFLIPPPMPRGHQYRAFGSVWQVKDQLPDLEVMGIKQLYKKSSSDEPTNYQYKISELKKLLKSLLLNYLGLAGVLSINPEGYEEKVNNIRTILVNIHHLLNEYRPHQSRESLIMLLEEQLEYKKNEIKKIEQVCQEVQKRLDKIQSNML
Length210
PositionMiddle
OrganismKazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-8276) (Yeast) (Kluyveromyces africanus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Kazachstania.
Aromaticity0.08
Grand average of hydropathy-0.781
Instability index50.28
Isoelectric point5.28
Molecular weight24582.63
Publications
PubMed=22123960

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery.
ECO:0000256	RuleBase:RU364060
GO - Cellular Component
core mediator complex	GO:0070847	IEA:EnsemblFungi
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:EnsemblFungi

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP28906
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     113.13|      31|      35|      95|     129|       1
---------------------------------------------------------------------------
   70-   93 (23.47/ 8.22)	.............PRGHQYRAFGSVWQV...KDQLpdLEV
   95-  129 (45.84/31.58)	GIKQLYkkssSDEPTNYQYKISELKKLL...KSLL..LNY
  131-  164 (43.82/22.37)	GLAGVL....SINPEGYEEKVNNIRTILvniHHLL..NEY
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP28906 with Med7 domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
1) EYKEQKETEKNDNDHDGEIEEEEVTNSELDFL
33
64

Molecular Recognition Features

MoRF SequenceStartStop
1) PYIRFFTEKNLAKLAEY
18
34