<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28905

Description Uncharacterized protein
SequenceMQTPLSISEVLTLTVKLEELETKFATNENSKQSVLDLVNETRSLILPIRLQLNEFISLMANIDKMTETSNIDKYNHIRKSLLTLQNNIQTLSQNFVKLNPLFNTIPEYSTKHNSREFKPLESLSNDPFAKGSPRTTSSGSANNTITSATSITTNANNKISAATPSSNINTPASSSQNITNTTPSIKKPRKPRQPRKSITQTNTANKASKTTTPSAPTPVAAPMQTPGTMNPALPVQNFNTKTPINLGSPNGPQFSPPPQQGQINFNDITPANILNMNQSRSIPNNNNNANNEMFGNLDLSNLDLNNLNMDFI
Length312
PositionTail
OrganismKazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-8276) (Yeast) (Kluyveromyces africanus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Kazachstania.
Aromaticity0.04
Grand average of hydropathy-0.637
Instability index45.78
Isoelectric point9.63
Molecular weight34161.92
Publications
PubMed=22123960

Function

Annotated function 
GO - Cellular Component
core mediator complex	GO:0070847	IEA:EnsemblFungi
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
RNA polymerase II activating transcription factor binding	GO:0001102	IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding	GO:0000979	IEA:EnsemblFungi
RNA polymerase II repressing transcription factor binding	GO:0001103	IEA:EnsemblFungi
transcription coactivator activity	GO:0003713	IEA:EnsemblFungi

GO - Biological Process
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly	GO:0051123	IEA:EnsemblFungi









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28905
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.55|      22|      24|     217|     239|       1
---------------------------------------------------------------------------
  217-  239 (37.77/21.21)	TPV..AAPmQTPGTMNPALPVQ.NFN
  242-  266 (32.78/13.74)	TPInlGSP.NGPQFSPPPQQGQiNFN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.70|      16|      46|     150|     165|       2
---------------------------------------------------------------------------
  150-  165 (29.67/12.57)	SIT.TNANNKIS.AATPS
  197-  214 (21.03/ 7.17)	SITqTNTANKASkTTTPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     103.61|      31|      33|      70|     100|       3
---------------------------------------------------------------------------
   31-   60 (19.91/ 6.91)	...........K...QSVLDLVNETRSLIlpirlqlNEFISLMA
   70-  100 (53.51/29.04)	N.IDKY..NHIR...KSLLTLQNNIQTLS.......QNFVKLNP
  103-  133 (30.19/13.68)	NtIPEYstKHNSrefKPLESLSND.............PFAKGSP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28905 with Med3 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) EYSTKHNSREFKPLESLSNDPFAKGSPRTTSSGSANNTITSATSITTNANNKISAATPSSNINTPASSSQNITNTTPSIKKPRKPRQPRKSITQTNTANKASKTTTPSAPTPVAAPMQTPGTMNPALPVQNFNTKTPINLGSPNGPQFSPPPQQGQINFNDITPANILNMNQSRSIPNNNNNANNEMFGNLDLS
107
300










Molecular Recognition Features






MoRF SequenceStartStop




NANANA