<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28902
| Description |
Uncharacterized protein |
| Sequence | MSGSYWTSMQRLQWQYSKSSLAKERQKLWLLECQLFPQGLNIVMDSKQNGQEIATAKNIPIVHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQLALATAHVYLSRFLLKASIREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFVPPDPTRVTEFEFYLIEELQSYLIVHHPYRSMEQIVQALNEPAYNLKLSPDDIQNCWSLINDSYITDIHLTSPPHIIAMACVFIAVSTQGDKSIKSMISQEAMTSQQETFNRFMAESQVDLEEVMDAIQELITLYDHWDKYHEPWIKFLLHTLYLRPSSPFPQQATGTTTNGSITNSLPT |
| Length | 332 |
| Position | Kinase |
| Organism | Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-8276) (Yeast) (Kluyveromyces africanus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kazachstania.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.203 |
| Instability index | 57.62 |
| Isoelectric point | 5.94 |
| Molecular weight | 38677.03 |
| Publications | PubMed=22123960
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by galactose GO:0000411 IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle GO:0010673 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP28902
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.36| 21| 107| 107| 145| 1
---------------------------------------------------------------------------
107- 127 (33.91/50.45) LLKASIR..EVNLYLLVTTCVYL
153- 175 (30.45/ 9.18) VPPDPTRvtEFEFYLIEELQSYL
---------------------------------------------------------------------------
|