<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28899
| Description |
Uncharacterized protein |
| Sequence | MSDQVLLEKLDQTTETLSVKLAELIRLSGLDNGVEETDGNENNIDNQTDLSIATTGVTIMNTQNTQLIKGVQDLLTLTRSIREKWLLNQIPEQDEGPKDSLKNTNHEGLESLLDKSMKEIVGEDAMTNI |
| Length | 129 |
| Position | Head |
| Organism | Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-8276) (Yeast) (Kluyveromyces africanus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kazachstania.
|
| Aromaticity | 0.01 |
| Grand average of hydropathy | -0.550 |
| Instability index | 23.44 |
| Isoelectric point | 4.28 |
| Molecular weight | 14323.84 |
| Publications | PubMed=22123960
|
Function
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP28899
No repeats found
No repeats found
|