Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MNDLTLGHRKSSSLSLLGEPPSTSITNSNNIDSASGASPAITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAGVEMSLSDDNSIALDEIKSVDAGEGPIPEKKDSSSRRGSYIFAGQSGKNAEHKNNEENKEEADNAVDLDLDLFNPDDF |
Length | 289 |
Position | Middle |
Organism | Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-8276) (Yeast) (Kluyveromyces africanus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Kazachstania. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.602 |
Instability index | 40.33 |
Isoelectric point | 4.79 |
Molecular weight | 32051.31 |
Publications | PubMed=22123960 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP28898 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 139.15| 44| 53| 180| 226| 1 --------------------------------------------------------------------------- 180- 226 (68.57/52.63) GPnnfVWPAED.ALRRGMLALAASHTDELTKIAGVEMSLSDDNSIALD 236- 280 (70.58/45.66) GP...IPEKKDsSSRRGSYIFAGQSGKNAEHKNNEENKEEADNAVDLD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) SSRRGSYIFAGQSGKNAEHK 2) VDLDLDLFNPDDF | 245 277 | 264 289 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab