<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28884
Description |
Serine/threonine-protein kinase SSN3 (Fragment) |
Sequence | MWRGVGYGGLHSHSSYPADRGLGHINYQPKVRVIERYKVVGFISSGTYGRVYKALGRQGQKGEFAIKKFKPDKEGEQISYTGISQSAIREMSLCSELKHANVIKLIEIILEDKCIFMVFEYAEHDLLQIIHHHTQNPRHPIPPQTVKSIMFQLLNGCQYLHANWILHRDLKPANIMVTSAGEVKIGDLGLARRFDKPLHSLFSGDKVVVTIWYRAPELILGSRHYTPAIDMWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVDIMGLPSKERWPLLTAMPEYPQLSTLQPPMTPHHHGHHGHXRGHGYGXHPPAPSGSNLEKWYYSTISQGASSSATSAPQGNGAPLASLGAEGYKLLASLLEYDPVERLTAAKALQHPFFSTGDRLNAHCFEGLKNEYPHRRVSQDDNDIRTSSLPGTKRSGLPDDSLARPVKKLRE |
Length | 448 |
Position | Kinase |
Organism | Colletotrichum higginsianum (strain IMI 349063) (Crucifer anthracnose fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum>
Colletotrichum destructivum species complex.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.433 |
Instability index | 37.01 |
Isoelectric point | 9.29 |
Molecular weight | 50001.73 |
Publications | PubMed=22885923
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28884
No repeats found
|