<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28880
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MADSAMTGAGAGATGEPFTLEERIQQLCEIDTSIVQLMHHTSSAMSALGAQKTPEINPEQQKQTFKSSMDALLSTLHTVDVHMKRQIMGLEEAGIIKLRGEGGGSGGPGEKSVGGRQVVMNEDAKIVARPSLEPNGVGTIGNLDVGWLNSRNNKVERDMEAELWAKMREFLERYHSQEQEASGEVSEMQQ |
| Length | 190 |
| Position | Head |
| Organism | Colletotrichum higginsianum (strain IMI 349063) (Crucifer anthracnose fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum>
Colletotrichum destructivum species complex.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.532 |
| Instability index | 41.36 |
| Isoelectric point | 4.99 |
| Molecular weight | 20624.95 |
| Publications | PubMed=22885923
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28880
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 97.56| 29| 29| 86| 114| 1
---------------------------------------------------------------------------
86- 114 (51.22/30.27) QIMGLEEAGII.KLRGEGGGSGGPGEKSVG
117- 146 (46.34/26.77) QVVMNEDAKIVaRPSLEPNGVGTIGNLDVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.42| 19| 36| 4| 26| 2
---------------------------------------------------------------------------
4- 26 (25.38/31.26) SAMTGAGAGATgePFTLEEriQQ
43- 61 (35.04/24.61) SAMSALGAQKT..PEINPE..QQ
---------------------------------------------------------------------------
|