<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28877
Description |
RNA polymerase II transcription mediator |
Sequence | MLWTRHLAQQFVASFHFVHRRHDLELLGPNDKIREVKQDPEQKEVDPLPPDEFKDGLAELARDLIIKEQQIEVLISTLPGLDSSEADQERYIRELEDELKVAEAQRQDAIKEKDQILAKLDEVIRSIRRP |
Length | 130 |
Position | Middle |
Organism | Colletotrichum higginsianum (strain IMI 349063) (Crucifer anthracnose fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum>
Colletotrichum destructivum species complex.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.715 |
Instability index | 47.17 |
Isoelectric point | 4.95 |
Molecular weight | 15229.07 |
Publications | PubMed=22885923
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28877
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.06| 19| 43| 51| 71| 1
---------------------------------------------------------------------------
51- 71 (27.89/32.54) DEFKdgLAELARDLIIKEQ.QI
97- 116 (28.16/23.02) DELK..VAEAQRQDAIKEKdQI
---------------------------------------------------------------------------
|