Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | NLLGISWVDSSWIPILNNGSVLDYFSERSNPFYDRTCNNEVVKMQRMTLDHLNQMVGVEYILLHAQEPILFIIRKQQRQSPTQVMPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFEEAMSYCRYHPSKGYWWHFKDEEEREKTKPKAKKKEEPSSIFQRQRVDALLLDLRQKFPPRFVQQKPGEKPIPVDQIKKEPEPVPEAVKTEEKETVKNAQSAGAKGPPEKRMRLQ |
Length | 237 |
Position | Head |
Organism | Taeniopygia guttata (Zebra finch) (Poephila guttata) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Passeriformes> Passeroidea> Estrildidae> Estrildinae> Taeniopygia. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.649 |
Instability index | 52.76 |
Isoelectric point | 8.90 |
Molecular weight | 27436.15 |
Publications | PubMed=20360741 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl nucleoplasm GO:0005654 IEA:Ensembl |
GO - Biological Function | DNA binding GO:0003677 IEA:Ensembl transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro stem cell population maintenance GO:0019827 IEA:Ensembl |
Binary Interactions |
Repeats | >MDP28852 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 82.51| 24| 41| 140| 163| 1 --------------------------------------------------------------------------- 140- 163 (39.95/20.25) HFKDEEEREKTKPKAKKKEEPSSI 183- 206 (42.56/21.95) RFVQQKPGEKPIPVDQIKKEPEPV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EKPIPVDQIKKEPEPVPEAVKTEEKETVKNAQSAGAKGPPEKRMRLQ 2) IFQRQRVDALLLDLRQKFPPRFVQQ | 191 163 | 237 187 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab