<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28847
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | LESDDTGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKEPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSVK |
| Length | 125 |
| Position | Middle |
| Organism | Taeniopygia guttata (Zebra finch) (Poephila guttata) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.15 |
| Grand average of hydropathy | -0.750 |
| Instability index | 33.03 |
| Isoelectric point | 8.73 |
| Molecular weight | 15344.38 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28847
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 106.11| 35| 44| 16| 59| 1
---------------------------------------------------------------------------
16- 57 (48.15/41.33) LEFVQCLanpNYLNFLaQRGYFKdKAFVN.....YL..KYLLYWKEpeY
61- 102 (57.96/24.30) LKYPQCL...HMLELL.QYEHFR.KELVNaqcakFIdeQQILHWQH..Y
---------------------------------------------------------------------------
|