<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28846
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MGEKFDSLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRGEDPPP |
Length | 134 |
Position | Middle |
Organism | Taeniopygia guttata (Zebra finch) (Poephila guttata) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.599 |
Instability index | 37.31 |
Isoelectric point | 5.46 |
Molecular weight | 15500.65 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28846
No repeats found
|