<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28843
Description |
Transcription elongation factor A2 |
Sequence | EGAMDLLKELKSMPMTLDLLQSTRIGMSVNALRKQSTDEEVISLAKSLIKSWKKLLDASEEKNEDKKKSLALPTSSSRETGNSRDQSSNKRQEPPKTPTTPKITTFPPAPITCDAVRNKCREMLTAALQADDDYIAIGADCEHIAAQIEEYILADVKNTDMKYKNRVRSRISNLKDSKNPELKKNVLCGAITPEQIAVMTSEEMASNELKEIRKAMTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSSDEPMTTFVVCNECGNRWKFC |
Length | 277 |
Position | Unknown |
Organism | Taeniopygia guttata (Zebra finch) (Poephila guttata) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.704 |
Instability index | 52.20 |
Isoelectric point | 8.71 |
Molecular weight | 31038.27 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28843
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.51| 11| 147| 110| 120| 2
---------------------------------------------------------------------------
110- 120 (22.54/13.97) PITCDAVRNKC
260- 270 (21.98/13.45) PMTTFVVCNEC
---------------------------------------------------------------------------
|