<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28843
| Description |
Transcription elongation factor A2 |
| Sequence | EGAMDLLKELKSMPMTLDLLQSTRIGMSVNALRKQSTDEEVISLAKSLIKSWKKLLDASEEKNEDKKKSLALPTSSSRETGNSRDQSSNKRQEPPKTPTTPKITTFPPAPITCDAVRNKCREMLTAALQADDDYIAIGADCEHIAAQIEEYILADVKNTDMKYKNRVRSRISNLKDSKNPELKKNVLCGAITPEQIAVMTSEEMASNELKEIRKAMTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSSDEPMTTFVVCNECGNRWKFC |
| Length | 277 |
| Position | Unknown |
| Organism | Taeniopygia guttata (Zebra finch) (Poephila guttata) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.704 |
| Instability index | 52.20 |
| Isoelectric point | 8.71 |
| Molecular weight | 31038.27 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28843
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.51| 11| 147| 110| 120| 2
---------------------------------------------------------------------------
110- 120 (22.54/13.97) PITCDAVRNKC
260- 270 (21.98/13.45) PMTTFVVCNEC
---------------------------------------------------------------------------
|