Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | GTTELTGSTNLIAHYTLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDSSSLRSLIEKPPICGSSFTPLTGAMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPGVGSSQASSSLR |
Length | 170 |
Position | Head |
Organism | Taeniopygia guttata (Zebra finch) (Poephila guttata) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Passeriformes> Passeroidea> Estrildidae> Estrildinae> Taeniopygia. |
Aromaticity | 0.04 |
Grand average of hydropathy | -1.208 |
Instability index | 66.56 |
Isoelectric point | 9.96 |
Molecular weight | 19055.69 |
Publications | PubMed=20360741 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP28840 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 89.55| 27| 113| 27| 56| 1 --------------------------------------------------------------------------- 27- 56 (44.53/23.77) KKVKEKLSN.FLPDLPGmidLPGSHDSSSLR 143- 170 (45.02/18.27) KKEKKKKKNrHSPEHPG...VGSSQASSSLR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.10| 14| 17| 98| 113| 2 --------------------------------------------------------------------------- 98- 111 (25.66/15.03) PPKKKNKHKHKQSR 117- 130 (25.44/ 8.42) PPETPSDSDHKKKK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPGV 2) HIQPPKKKNK | 123 95 | 160 104 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab