<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28840
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | GTTELTGSTNLIAHYTLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDSSSLRSLIEKPPICGSSFTPLTGAMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPGVGSSQASSSLR |
| Length | 170 |
| Position | Head |
| Organism | Taeniopygia guttata (Zebra finch) (Poephila guttata) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Passeroidea> Estrildidae>
Estrildinae> Taeniopygia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.208 |
| Instability index | 66.56 |
| Isoelectric point | 9.96 |
| Molecular weight | 19055.69 |
| Publications | PubMed=20360741
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28840
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.55| 27| 113| 27| 56| 1
---------------------------------------------------------------------------
27- 56 (44.53/23.77) KKVKEKLSN.FLPDLPGmidLPGSHDSSSLR
143- 170 (45.02/18.27) KKEKKKKKNrHSPEHPG...VGSSQASSSLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.10| 14| 17| 98| 113| 2
---------------------------------------------------------------------------
98- 111 (25.66/15.03) PPKKKNKHKHKQSR
117- 130 (25.44/ 8.42) PPETPSDSDHKKKK
---------------------------------------------------------------------------
|