<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28837
| Description |
Mediator complex subunit 22 |
| Sequence | MAQPRVLPQSKETLLQSYNKRLKDDVKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAINQRNQQLRSLQEECDKKLIALRDEISIDLYELEEEYYSSSYSLCDSNDLPLCEAYWRQDFATLSPESLSMPLAAATAEQSGATSQSSTPSHPHVNGHGAGPAEHS |
| Length | 203 |
| Position | Head |
| Organism | Taeniopygia guttata (Zebra finch) (Poephila guttata) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.620 |
| Instability index | 67.26 |
| Isoelectric point | 4.77 |
| Molecular weight | 22796.08 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28837
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.72| 18| 19| 132| 149| 1
---------------------------------------------------------------------------
132- 149 (34.01/19.02) EEYYSSSY.SLC.DSNDLPL
151- 170 (23.71/11.59) EAYWRQDFaTLSpESLSMPL
---------------------------------------------------------------------------
|