<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28837
Description |
Mediator complex subunit 22 |
Sequence | MAQPRVLPQSKETLLQSYNKRLKDDVKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAINQRNQQLRSLQEECDKKLIALRDEISIDLYELEEEYYSSSYSLCDSNDLPLCEAYWRQDFATLSPESLSMPLAAATAEQSGATSQSSTPSHPHVNGHGAGPAEHS |
Length | 203 |
Position | Head |
Organism | Taeniopygia guttata (Zebra finch) (Poephila guttata) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.620 |
Instability index | 67.26 |
Isoelectric point | 4.77 |
Molecular weight | 22796.08 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28837
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.72| 18| 19| 132| 149| 1
---------------------------------------------------------------------------
132- 149 (34.01/19.02) EEYYSSSY.SLC.DSNDLPL
151- 170 (23.71/11.59) EAYWRQDFaTLSpESLSMPL
---------------------------------------------------------------------------
|