<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28835

Description Mediator complex subunit 24
SequenceLAEALLEQAMIGPSPNPLILSYLKYAISSQMVSYSTVLMAISKFDDFSRDWGSVAVEIMDMFCDRLSCHGKAEECISLCRALLSALTWLLRCATFYAEKVKEPLEQAAAENQLKMCLERLEKMLSSTKNRALIHIAKLEETSSWSTVEQSLIKLGENLNNLGSSPLRNQADDCVSLIKSIPTMLSVHSEQLNKTGFPTVHAVVLLEGTMNLTGETQPLVEQLMMVKRMQRIPSPLFVLEIWACFVGLIECPEGTEEKWTAFTFLKMPQVLVKLKKYPQGDKDFTEDVNSAFEFLLKLTPLLDKADQRCNCNCMSLLLQECSKQGLLSEANMNNLIDKRAADKENSPSLKSAENANIQPNPGLILRAEPTVTNILKTMDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKSFARKFVKLNEFTKQITGEISKSGPVRALLFDISFLMLCHVAQTYGSEVRILGEDEKTPCCPFFEIWMVTCMPEEGKILNPDHSCFRPDSTKVESLVALLNNSSEMKLVQMKWHEVCLSISAAILEILNAWENGVLTFESIQKITDNIKGKVCSMAVCAVAWLVAHVRMLGLDEREKSLQMIRQLATPLYGENTLQFYNERVVIMSSILEHMCADVLQQTATQIKFPSTGMDTIPYWNLLPPKKPIKEVLTSVFTKVLEKGWVDSHSIHIFDTLLHMGGVYWFCNNLVKELLKETRKEHTLRAVELLYAIFCLDMQQLTLTLLGHILPNLLTDSSKWHTLMDPPGKALAKLSVWCALSSYSSHSKVQASARQKKRHREDIEDYISLFPLDDTQPSKLMRLLSSNEEDSNILSSPNRSMSSSLSASQLHTVSMRDPLNRVLGKVGMGPWGHIQPLAHQWGVWWFMEECVECLEQGSRGSILQFMPSPWWVSELVKVSTMSSPKIVLAITDLTLPLGRRVAAKAIAAL
Length941
PositionTail
OrganismTaeniopygia guttata (Zebra finch) (Poephila guttata)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Passeriformes> Passeroidea> Estrildidae> Estrildinae> Taeniopygia.
Aromaticity0.07
Grand average of hydropathy-0.012
Instability index48.59
Isoelectric point6.31
Molecular weight105278.63
Publications
PubMed=20360741

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP28835
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.81|      18|     116|     454|     472|       1
---------------------------------------------------------------------------
  454-  472 (29.33/23.23)	CHVAqTYGSEVRILGEDEK
  573-  590 (34.47/22.32)	CAVA.WLVAHVRMLGLDER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     274.58|      73|     302|     499|     571|       2
---------------------------------------------------------------------------
  499-  571 (119.89/71.43)	SCFRPDSTKVESLVALL.NNSSEMKLVQMKWHEVCLSISAAILEILNAWE..NGVLTFESIQKITDNIKGKVCSMA
  751-  793 (53.14/27.59)	.............................KWHTL.MDPPGKALAKLSVW...CALSSYSSHSKVQASARQKKRHRE
  800-  870 (101.54/59.38)	SLFPLDDTQPSKLMRLLsSNEEDSNILSSPNRSMSSSLSASQLHTVSMRDplNRVL.....GKVGMGPWGHIQPLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.39|      25|     298|      82|     129|       4
---------------------------------------------------------------------------
   88-  118 (39.38/50.46)	WllrcatFYAEKVKEPLEQAAAENQLK........MCLE
  697-  729 (40.01/10.22)	W......FCNNLVKELLKETRKEHTLRavellyaiFCLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.99|      22|      37|     325|     346|       5
---------------------------------------------------------------------------
  325-  346 (36.41/19.51)	LLSEANMNNLIDKRAADKENSP
  364-  385 (37.59/20.34)	LRAEPTVTNILKTMDADHSKSP
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP28835 with Med24 domain of Kingdom Metazoa

Unable to open file!