<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28833
Description |
Mediator of RNA polymerase II transcription subunit 1 |
Sequence | ISTNALMEQLHLKYQQRPWTETLKLVYFCMDNPHRKPVSNAPDGLLLSCMEKIERTLNAKSMFSVMNILELVARQKGLTVHVSPSGTACYITSMMFYLEIQLEKDGDVMDVKLAHFEEAPVVCDDLVQLLRMKNYDAFGKILEDLSNMYQIPGNSEMKAKGYLALQALEKDLYSMSLLDRTQDLNRVTEVLNGKVGHLVPRTGGTPMNIEFYISPYQVLEAELSHGSEVCGTKTVVTVEGTDMLHKLPLSPLIIEPQTGEDSNPSFLQLTDELSMDLPAHFVLKFHQPVPMSSSSIEEIQKLTGIQISGLKLAPLYELIVQSTLKEKCSEDLSTNKCCFFVSLPDCSKHCYFINKGSEKPGLAGALVSKIPFSHPKCVPGVIEILRHQVAYNTLISSCVSEKHINEDDSELLYFEVVPYKNTSFSVFFLHPVKKNLACVVIDVITSREVQCHLHLNPQDPTLNSTDDFIARAVKRCMSVPVVMRAVFRNAAKVKADS |
Length | 497 |
Position | Middle |
Organism | Taeniopygia guttata (Zebra finch) (Poephila guttata) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Passeroidea> Estrildidae>
Estrildinae> Taeniopygia.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.059 |
Instability index | 47.21 |
Isoelectric point | 5.91 |
Molecular weight | 55639.93 |
Publications | PubMed=20360741
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364059
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP28833
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.38| 29| 200| 142| 195| 1
---------------------------------------------------------------------------
97- 126 (46.34/51.40) YLEIQ.LEKDGDVMDVkLAHFEE....APVVCDDL
162- 195 (38.04/27.94) YLALQaLEKDLYSMSL.LDRTQDlnrvTEVLNGKV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.01| 21| 68| 234| 260| 3
---------------------------------------------------------------------------
204- 225 (33.49/24.59) GTPMNIEFYISPYqVLEAELSH
240- 260 (37.53/20.38) GTDMLHKLPLSPL.IIEPQTGE
---------------------------------------------------------------------------
|