<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28832

Description Transcription elongation factor A3
SequenceMGPAEELVRIAKKLDKMVARKSTEGALDLLKSLTGYTMTIQLLQTTRIGVAVNSVRKHCSDEEVVASAKILIKNWKRLLGDPNAFWGDREKDTDGDKEKKGLDVSSCPTTSGTAPGQFLKEGEPLTGRASADSRSSTLSSSSSSQKRLANSSNVKTEVPRSPTSPSFSPSPCFLAPCYLTGDSVRDKCIEMLTAALRMDDDYKEFGVNCEKMASEIEDHILGLGSTDMKYRNRVRSRISNLKDPKNPALRRNVLCGAIEPSLIARMTAEEMASDELKKLRNAMTQEAIREHQMAKTGGTVTDLFQCGKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKVC
Length344
PositionUnknown
OrganismTaeniopygia guttata (Zebra finch) (Poephila guttata)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Passeriformes> Passeroidea> Estrildidae> Estrildinae> Taeniopygia.
Aromaticity0.04
Grand average of hydropathy-0.555
Instability index50.67
Isoelectric point8.87
Molecular weight37908.94
Publications
PubMed=20360741

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
nucleic acid binding	GO:0003676	IEA:InterPro
zinc ion binding	GO:0008270	IEA:InterPro

GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro
transcription, DNA-templated	GO:0006351	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28832
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.78|      16|      27|     134|     149|       1
---------------------------------------------------------------------------
  134-  149 (26.52/13.06)	RSSTLSSSSSSQKRLA
  160-  175 (32.26/17.13)	RSPTSPSFSPSPCFLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.10|      23|      27|     292|     314|       2
---------------------------------------------------------------------------
  292-  314 (42.61/27.20)	QMAKTGGTVTDLFQCGKC..KKKNC
  320-  344 (39.49/24.72)	QTRSADEPMTTFVLCNECgnRWKVC
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28832 with Med26 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GTAPGQFLKEGEPLTGRASADSRSSTLSSSSSSQKRLANSSNVKTEVPRSPTSP
112
165










Molecular Recognition Features






MoRF SequenceStartStop




NANANA