<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28832
| Description |
Transcription elongation factor A3 |
| Sequence | MGPAEELVRIAKKLDKMVARKSTEGALDLLKSLTGYTMTIQLLQTTRIGVAVNSVRKHCSDEEVVASAKILIKNWKRLLGDPNAFWGDREKDTDGDKEKKGLDVSSCPTTSGTAPGQFLKEGEPLTGRASADSRSSTLSSSSSSQKRLANSSNVKTEVPRSPTSPSFSPSPCFLAPCYLTGDSVRDKCIEMLTAALRMDDDYKEFGVNCEKMASEIEDHILGLGSTDMKYRNRVRSRISNLKDPKNPALRRNVLCGAIEPSLIARMTAEEMASDELKKLRNAMTQEAIREHQMAKTGGTVTDLFQCGKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKVC |
| Length | 344 |
| Position | Unknown |
| Organism | Taeniopygia guttata (Zebra finch) (Poephila guttata) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Passeroidea> Estrildidae>
Estrildinae> Taeniopygia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.555 |
| Instability index | 50.67 |
| Isoelectric point | 8.87 |
| Molecular weight | 37908.94 |
| Publications | PubMed=20360741
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28832
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.78| 16| 27| 134| 149| 1
---------------------------------------------------------------------------
134- 149 (26.52/13.06) RSSTLSSSSSSQKRLA
160- 175 (32.26/17.13) RSPTSPSFSPSPCFLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.10| 23| 27| 292| 314| 2
---------------------------------------------------------------------------
292- 314 (42.61/27.20) QMAKTGGTVTDLFQCGKC..KKKNC
320- 344 (39.49/24.72) QTRSADEPMTTFVLCNECgnRWKVC
---------------------------------------------------------------------------
|