| Description | Mediator of RNA polymerase II transcription subunit 24 (Fragment) |
| Sequence | XGQASTRQKKRHREDIEDYISLFPLDDVQPSKLMRLLSSNEDDANILSSPTDRSMSSSLSASQLHTVNMRDPLNRVLVPPSPRV |
| Length | 84 |
| Position | Tail |
| Organism | Homo sapiens (Human) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.728 |
| Instability index | 79.45 |
| Isoelectric point | 6.94 |
| Molecular weight | 9346.39 |
| Publications | PubMed=16625196 PubMed=18691976 PubMed=18669648 PubMed=19413330 PubMed=19369195 PubMed=19690332 PubMed=20068231 PubMed=21406692 PubMed=23186163 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP28827 No repeats found No repeats found |
| Disease |
| MoRF Sequence | Start | Stop |
| NA | NA | NA |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab