<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28826
Description |
Cyclin-C (Fragment) |
Sequence | LKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNRNSLSDSPLVAGPEAAR |
Length | 228 |
Position | Kinase |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Homo.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.050 |
Instability index | 47.45 |
Isoelectric point | 8.62 |
Molecular weight | 26513.03 |
Publications | PubMed=14574404
PubMed=19369195
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP28826
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.35| 13| 24| 161| 174| 1
---------------------------------------------------------------------------
161- 174 (20.63/18.50) QW..FAELSvDMEKIL
186- 200 (20.73/13.20) QWknFDERK.EMATIL
---------------------------------------------------------------------------
|
Associated diseases