<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28825
| Description |
Mediator of RNA polymerase II transcription subunit 28 (Fragment) |
| Sequence | PLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPTHLTG |
| Length | 179 |
| Position | Head |
| Organism | Homo sapiens (Human) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Homo.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.483 |
| Instability index | 58.75 |
| Isoelectric point | 5.57 |
| Molecular weight | 19655.04 |
| Publications | PubMed=15815621
PubMed=21269460
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28825
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.84| 15| 16| 114| 129| 2
---------------------------------------------------------------------------
114- 129 (21.37/18.09) ELRNELQ.RKDALVQkH
132- 147 (24.48/15.59) KLRHWQQvLEDINVQ.H
---------------------------------------------------------------------------
|
Associated diseases