<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28824

Description Cyclin dependent kinase 19
SequenceMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDEPEEKGDKKNQQQQQNQHQQTTAPPQPAAAPPQAPPPQQNSTQTNGTTGGAGAGVGGAGAGLQHSQDSGLNQVPPSKKPRLGPSGTNSGGPVMPSEYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQSSQYHSSHQAHRY
Length443
PositionKinase
OrganismOtolemur garnettii (Small-eared galago) (Garnett's greater bushbaby)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lorisiformes> Galagidae> Otolemur.
Aromaticity0.08
Grand average of hydropathy-0.652
Instability index58.41
Isoelectric point8.90
Molecular weight49962.00
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28824
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.98|      22|      32|     351|     373|       1
---------------------------------------------------------------------------
  351-  373 (36.45/26.28)	GGAGAGVGG..AGAGLQHSqDSGLN
  384-  407 (38.53/23.04)	GPSGTNSGGpvMPSEYQHS.SSRLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.44|      15|      41|      91|     105|       2
---------------------------------------------------------------------------
   91-  105 (26.77/21.18)	DLKPANILVMGEGPE
  129-  143 (28.67/23.26)	DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     112.67|      30|      42|     268|     297|       3
---------------------------------------------------------------------------
  268-  297 (55.71/23.34)	QALQDPYFQEDPLPTLDVFAGCQIPYPKRE
  313-  342 (56.96/23.99)	QQQQQNQHQQTTAPPQPAAAPPQAPPPQQN
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28824 with CDK8 domain of Kingdom Metazoa
Unable to open file!