<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28819
Description |
Transcription elongation factor A1 |
Sequence | MEDEVVRIAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGPSSDKDPEEKKKEPAITSQNSPEAKEESSSSGTISSRKDETNARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIAIGADEEELGSQIDLIPIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKKIC |
Length | 303 |
Position | Unknown |
Organism | Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lorisiformes>
Galagidae> Otolemur.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.772 |
Instability index | 44.81 |
Isoelectric point | 8.86 |
Molecular weight | 34040.55 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleolus GO:0005730 IEA:Ensembl
transcription factor TFIID complex GO:0005669 IEA:Ensembl
|
GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP28819
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.31| 24| 28| 246| 272| 5
---------------------------------------------------------------------------
246- 272 (39.41/33.44) IrehQMAKTGGTQTDLFTCGKCK...KKNC
277- 303 (37.90/23.43) V...QTRSADEPMTTFVVCNECGnrwKKIC
---------------------------------------------------------------------------
|