<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28817
Description |
Uncharacterized protein |
Sequence | MAAPQQQASAATTAAGVSGPGSAGGPGPQQQPQPPAQLVGPAQSGLLQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKTQIACAKDIHTALLDCANKVTGKTPAPPTGPGGTL |
Length | 198 |
Position | Tail |
Organism | Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lorisiformes>
Galagidae> Otolemur.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.347 |
Instability index | 64.63 |
Isoelectric point | 5.86 |
Molecular weight | 20868.50 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28817
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.13| 15| 18| 19| 35| 1
---------------------------------------------------------------------------
19- 35 (27.43/15.74) GPGSAGgpGPQQQPQPP
40- 54 (28.69/10.67) GPAQSG..LLQQQDFDP
---------------------------------------------------------------------------
|