<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28795
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFTALFGAQADPPPPPTALSFGPGKPPPPPPPPPGGGPGTAPPPTAATNPPGGDKSAAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKQKYKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
| Length | 244 |
| Position | Head |
| Organism | Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lorisiformes>
Galagidae> Otolemur.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.043 |
| Instability index | 63.64 |
| Isoelectric point | 9.81 |
| Molecular weight | 26342.82 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28795
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.12| 16| 16| 190| 205| 2
---------------------------------------------------------------------------
170- 183 (24.95/11.65) P..PKKKNKQKYKQSR
190- 205 (27.40/13.51) PETPSDSDHKKKKKKK
209- 224 (26.77/13.03) PERKRKKKEKKKKKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 101.30| 21| 115| 110| 130| 4
---------------------------------------------------------------------------
70- 89 (29.01/12.29) .ELPGSTELTGSTNLITHYNL
110- 130 (40.30/19.34) PDLPGMIDLPGSHDNSSLRSL
227- 243 (31.98/14.15) PDHPGM....GSSQASSSSSL
---------------------------------------------------------------------------
|