Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MASAGVAAGRQAEDALPPSSEPPPDTKSLPPPQPPPPVAAPQPQQSPAPRPQSPALVREEENYSFLPLVHNIIKCMDKDSPDIHQDLNALKSKFQEMRKLISTMPGIHLSPEQQQLLLHSLREQVRTKNELLQKYKSLCMFEIPKE |
Length | 146 |
Position | Middle |
Organism | Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lorisiformes> Galagidae> Otolemur. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.681 |
Instability index | 95.25 |
Isoelectric point | 6.42 |
Molecular weight | 16255.51 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP28789 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.90| 17| 18| 17| 33| 1 --------------------------------------------------------------------------- 17- 33 (35.23/13.58) PPSSEPPPDTKSLPPPQ 36- 52 (34.67/13.26) PPVAAPQPQQSPAPRPQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RPQSPALVREEENYSFLP 2) VAAGRQA | 50 6 | 67 12 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab