| Description | Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | MASAGVAAGRQAEDALPPSSEPPPDTKSLPPPQPPPPVAAPQPQQSPAPRPQSPALVREEENYSFLPLVHNIIKCMDKDSPDIHQDLNALKSKFQEMRKLISTMPGIHLSPEQQQLLLHSLREQVRTKNELLQKYKSLCMFEIPKE |
| Length | 146 |
| Position | Middle |
| Organism | Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lorisiformes> Galagidae> Otolemur. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.681 |
| Instability index | 95.25 |
| Isoelectric point | 6.42 |
| Molecular weight | 16255.51 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP28789
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.90| 17| 18| 17| 33| 1
---------------------------------------------------------------------------
17- 33 (35.23/13.58) PPSSEPPPDTKSLPPPQ
36- 52 (34.67/13.26) PPVAAPQPQQSPAPRPQ
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) RPQSPALVREEENYSFLP 2) VAAGRQA | 50 6 | 67 12 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab