<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28786
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFTALFGAQTDPPPPPTALSFGPGKPPPPPPPPPGGGPGTAAPPTAATAPPGADKSAAGCGPFYLMRELPGGTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLSGFRLHTGPLPEQCRLMHIQPPKKNKHKHKQSRAQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKSRHSPDHPGMGSSQASSSSSLR |
| Length | 243 |
| Position | Head |
| Organism | Cavia porcellus (Guinea pig) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Caviidae>
Cavia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.991 |
| Instability index | 65.98 |
| Isoelectric point | 9.80 |
| Molecular weight | 26101.54 |
| Publications | PubMed=21993624
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28786
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.92| 16| 16| 189| 204| 2
---------------------------------------------------------------------------
189- 204 (27.85/11.30) PETPSDSDHKKKKKKK
208- 223 (26.07/10.21) PERKRKKKEKKKKKSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 57.45| 14| 40| 67| 80| 4
---------------------------------------------------------------------------
67- 80 (23.15/11.49) LMRE........LPGG.TELTGS
85- 99 (18.14/ 7.59) THYN........LEQAyNKFCGK
100- 121 (16.15/ 6.04) KVKEklsnflpdLPGM.IDLPGS
---------------------------------------------------------------------------
|