<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28774

Description Uncharacterized protein
SequenceMSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASAAAAAAAATATTTAATTAPAAASQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPSSKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNKKGNYILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDTCVHDLQAHSKEIYTIKWSPTGPATSNPNANIMLASASFDSTVRLWDVERGVCIHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGSLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK
Length526
PositionTail
OrganismCavia porcellus (Guinea pig)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Caviidae> Cavia.
Aromaticity0.07
Grand average of hydropathy-0.278
Instability index38.12
Isoelectric point5.40
Molecular weight56737.55
Publications
PubMed=21993624

Function

Annotated function 
GO - Cellular Component
transcription regulator complex	GO:0005667	IEA:Ensembl

GO - Biological Function
chromatin binding	GO:0003682	IEA:Ensembl
transcription corepressor activity	GO:0003714	IEA:Ensembl
transcription regulatory region sequence-specific DNA binding	GO:0000976	IEA:Ensembl

GO - Biological Process
fat cell differentiation	GO:0045444	IEA:Ensembl
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:Ensembl
proteasome-mediated ubiquitin-dependent protein catabolic process	GO:0043161	IEA:Ensembl
protein stabilization	GO:0050821	IEA:Ensembl
response to estrogen	GO:0043627	IEA:Ensembl
response to steroid hormone	GO:0048545	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28774
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             8|     371.23|      40|      40|     334|     373|       1
---------------------------------------------------------------------------
  177-  206 (34.18/18.36)	..............LRGHESE...........VFICAWNPVS.........dlL.ASGS.GDSTAR
  225-  262 (42.91/25.11)	HCirEGGHDVP..S....NKD...........VTSLDWNSDG.........tlL.ATGS.YDGFAR
  263-  292 (31.31/16.14)	I...WTEDGNLASTLGQHKGP...........IFALKWNKKG..........nY............
  293-  344 (44.81/26.58)	IL..SAGVDKTTIIWDAHTGEakqqfpfhsapALDVDWQNNT..........tF.ASCS.TDMCIH
  345-  386 (62.80/40.48)	VC..RLGCDRPVKTFQGHTNE...........VNAIKWDPSG.........mlL.ASCS.DDMTLK
  387-  437 (58.69/37.30)	IW..SMKQDTCVHDLQAHSKE...........IYTIKWSPTGpatsnpnanimL.ASAS.FDSTVR
  441-  479 (50.47/30.96)	VE..RGVC...IHTLTKHQEP...........VYSVAFSPDG..........kYlASGS.FDKCVH
  480-  521 (46.07/27.55)	IW..NTQSGSLVHSYRG.TGG...........IFEVCWNARG........dkvG.ASASdGSVCV.
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28774 with Med16 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AAAATATTTAATTAPAAASQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPSSKA
114
174










Molecular Recognition Features






MoRF SequenceStartStop




1) FLVYRY
10
15