<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28765
| Description |
Mediator complex subunit 22 |
| Sequence | MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRALQEECDRKLITLRDEVSIDLYELEEEYYSSSSSLCEANDLPLCEAYWRLDLDTDSADCLSAPLLASPEPGTGSLQVAAPAHSHAGGSGPTEHT |
| Length | 200 |
| Position | Head |
| Organism | Cavia porcellus (Guinea pig) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Caviidae>
Cavia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.557 |
| Instability index | 59.61 |
| Isoelectric point | 4.56 |
| Molecular weight | 22361.64 |
| Publications | PubMed=21993624
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28765
No repeats found
No repeats found
|