<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28748
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MYELFLTALVEDSDINTALAVLSGFCSMQPWESISRVLYFQGPPRPSGITNQRSFEKPMRKDSALLWKELHQNLSRQSFVLQARYEILKDRDLGPQAESVDLNLVPGILRWTDFPDPPRGQPILAQRKKVELWEQRKLPSILQENNYQLKTETVEETYQFFRDDVEFCLTRHYFVGPIDDYVPLANMPAAPTGPKSSLPAWESLTQVDMQSRWILQVKAHVVQDNKPDEIKKAQDQLLKFRADLDGVFDFKVIDRKVHDTRVAMQQQGVQALPQKVLLGKS |
| Length | 281 |
| Position | Head |
| Organism | Hypocrea atroviridis (strain ATCC 20476 / IMI 206040) (Trichoderma atroviride) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.471 |
| Instability index | 46.81 |
| Isoelectric point | 6.14 |
| Molecular weight | 32412.70 |
| Publications | PubMed=21501500
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28748
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.57| 20| 73| 34| 53| 1
---------------------------------------------------------------------------
34- 53 (38.88/21.28) ISRVLYFQGPPRPSGITNQR
108- 127 (40.69/22.56) ILRWTDFPDPPRGQPILAQR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 110.33| 33| 131| 58| 90| 3
---------------------------------------------------------------------------
58- 90 (56.57/32.18) PMRKDSAL.LWKELHQNLSRQSFVLQARYEILKD
191- 224 (53.76/30.30) PTGPKSSLpAWESLTQVDMQSRWILQVKAHVVQD
---------------------------------------------------------------------------
|