<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28743

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMEGRIPISEALRESIKYWSSFVSKCLTKRLDASTFEDYVQLVQSRHRLPPEIIADFFIRPIKSNCVSPDPRIPPYISILTKLRYTDAVSILRSLYRYSSLHALVPEQAQHDGDGANGEGAARQDAQPASSLRWKSSSWLEEVMFYHVIKLLVEGTAFRDSRTALELIHISSKWMVLFTTASNSMTADMLGGSLQDPQVRHEMETAWGALVPLVLRLVDNAAFVKVISQPSAKGARKVFSDSLASFVQVIQQSPQLPQFQQFINKLELFRTEVLAPLDPVDKSKQAANAVMDDILDSTVGVDNLVIPEVPITNTRAGLYIYLGASLVGRPLIDDHALFSYLNNRYQGDVQQSAVDLILASFDLLANAVFRNEGPRDAQLLRSFLINKVPLILAQLCPPGFSTPSAEFCITQALPHVDTSVFPTASLMFDESRNNNPYTESVREDFCSACALHGLIEREHVERILGESSMSYEPSQEKYSKEKLVQSCLSDPDKIQALIRDMDKMDGNVGAVCQALVELLRQLCHSKDTMSLKILCSQLVQKPQSLDILLLFEKLPTILEPICQLLDSWRYEEDQGEYQPVYEEFGAILLLVLAFAYRYSLTPADIGIISPDSNVAKIIGRAHIGRELDELSEQENGHLGGWIHGLFDSDAGGLGDDLMSSCPPADFYLLTATLFQNIVIAYTQGFLTDDALRSGVEYLIDTFLLPSLIPAIRFLSDYLWVEQKEQKSIIKILQLILLPTSISGEATTMLASVKGIVAKPLEHSLRSYQRQDPKNQDIEPLLRVLKDSLPFSRRTGAAEHQELELWATSSSSGLSGAAKHLIQGLVQWCVHTDETAMPTSYTHRQVIATLKIVGASRLLRVILEEIRHQTLAGNGSLVYDVATALVCAPNVSNELPPTSGLLDETGNMLPMLQRPLTLREVLKMEAEDYRKLQKKDAELAEIVVRLHRRVEAQMVLPPPPMLQAADMQLDLAGDATNLEDSIVVAAGVSGDGTMSMDGVGSLDMGLGGISSDLGLGGPGSNGGLDASAEADLFGSLDDTDMDVFDGWGGMDLGGP
Length1053
PositionTail
OrganismHypocrea atroviridis (strain ATCC 20476 / IMI 206040) (Trichoderma atroviride)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
Aromaticity0.07
Grand average of hydropathy-0.039
Instability index45.06
Isoelectric point4.87
Molecular weight115916.17
Publications
PubMed=21501500

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28743
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     122.65|      38|      45|     966|    1003|       3
---------------------------------------------------------------------------
  966- 1003 (66.20/41.26)	QLDLAGDATN..LEDSIVVAA.GVSGDGTMSM.DGVGSLDMG
 1010- 1051 (56.44/34.02)	DLGLGGPGSNggLDASAEADLfGSLDDTDMDVfDGWGGMDLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     110.41|      33|      49|      82|     115|       4
---------------------------------------------------------------------------
   82-  115 (52.42/48.01)	LRYTDAvSILRSLYRYSSLHALVPEQAQHDGDGA
  131-  163 (57.99/47.68)	LRWKSS.SWLEEVMFYHVIKLLVEGTAFRDSRTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.06|      19|      49|     230|     248|       5
---------------------------------------------------------------------------
  230-  248 (31.39/23.03)	SAKGARKVFSDSLASFVQV
  282-  300 (31.68/23.31)	SKQAANAVMDDILDSTVGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     106.24|      37|      49|     473|     518|       7
---------------------------------------------------------------------------
  473-  518 (48.04/53.56)	SQEKYS....KEKLVQsclsDPDKIQALIRdMDKMDGNVGAVCQalveLL
  524-  564 (58.20/37.05)	SKDTMSlkilCSQLVQ....KPQSLDILLL.FEKLPTILEPICQ....LL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      96.40|      30|      50|     656|     685|       9
---------------------------------------------------------------------------
  656-  685 (54.30/37.44)	LMSSCPPA.DF...YLLTATLFQNIVIAYTQGFL
  702-  735 (42.10/27.32)	LLPSLIPAiRFlsdYLWVEQKEQKSIIKILQLIL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28743 with Med5 domain of Kingdom Fungi
Unable to open file!