<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28741
Description |
Uncharacterized protein (Fragment) |
Sequence | MERSQPASSNLMDNHNRLVADILTRYRTLMMLATVQAEQDRNNANPEAMAVTGISIKMEFDGLYTSIKEFLTLSRKIKELWIFGPLGTEDSDRKEKEEQLDQDVNRVSELLNQMEASKMKSLAESHGGTWQ |
Length | 131 |
Position | Head |
Organism | Hypocrea virens (strain Gv29-8 / FGSC 10586) (Gliocladium virens) (Trichoderma virens) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.646 |
Instability index | 38.41 |
Isoelectric point | 5.07 |
Molecular weight | 14964.76 |
Publications | PubMed=21501500
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP28741
No repeats found
No repeats found
|