Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDTYIDGRFERLEKALATLIDSVTKYHPSAIQAEELKAADNELCKGLEQVEIHQNNHLKILQLRQLSTSLDAQIRETLSSLATTRKDIVNTQVTIYPSEPNFPILYEELLGHARRISKTSMPPAAILNAMAATQESQTPLPDSQAQSAMTPSAQTPNPMQSPAPTNGIIEQSAQQAQASLHTTLPDNMNQFLNPLSGQLFFPWPLEDKIRSGALASNQILLEQGIDPRGYDPVAEEERKRKEEEERKEKEEKEKQERAEREKEAERHRQERQRQIEKQQAEWRRASTAVGASGDAAVAAPPSAKAEKKQFQFTNLDDLDDDDDED |
Length | 325 |
Position | Middle |
Organism | Hypocrea virens (strain Gv29-8 / FGSC 10586) (Gliocladium virens) (Trichoderma virens) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.888 |
Instability index | 53.21 |
Isoelectric point | 4.93 |
Molecular weight | 36562.17 |
Publications | PubMed=21501500 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP28737 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.51| 16| 16| 240| 255| 1 --------------------------------------------------------------------------- 240- 255 (25.58/15.30) RKEEEERKEKEEKEKQ 257- 272 (26.93/16.48) RAEREKEAERHRQERQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 59.92| 18| 18| 137| 154| 2 --------------------------------------------------------------------------- 118- 135 (28.62/12.80) KTSMPPAAILNAMAATQE 137- 154 (31.30/14.53) QTPLPDSQAQSAMTPSAQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.46| 15| 18| 185| 200| 3 --------------------------------------------------------------------------- 156- 170 (29.20/16.15) PNPM.QSPAPTNGIIE 185- 200 (24.26/17.19) PDNMnQFLNPLSGQLF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GDAAVAAPPSAKAEKKQFQFTNLDDLDDDDDED 2) IEKQQAEWRRASTAV | 293 275 | 325 289 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab