<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28731
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MANPNDPPLDEIQWRSPQIVAQMGGLHSNTILFYFAESPFFERTSNNAVIMAQAMNNMAMYHYIQTREAFETRLKTMSGLEFIVGEEPAETGPGMGTGVWVIRKQTRRKRYQDDDEITVHASFFVVGENIYMAPTLADILASRIMTISSAIAKALPAAEAARKWRPSTGHVYQLPASQPSTQPKPQEPKEENPALDDTGKPVSAVAKHEAPFIDRVAEESFMIHLRYGGEYIDENPITGKPGEFHLSSTGRKPVLPPQGAAPTGISAMSGPPMLNTKLDDKKDGRADKTPKSATMPKLKRKKSKMSPSVTPAATPGAS |
| Length | 318 |
| Position | Head |
| Organism | Hypocrea virens (strain Gv29-8 / FGSC 10586) (Gliocladium virens) (Trichoderma virens) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.513 |
| Instability index | 52.01 |
| Isoelectric point | 8.57 |
| Molecular weight | 34822.30 |
| Publications | PubMed=21501500
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28731
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.05| 12| 17| 155| 170| 1
---------------------------------------------------------------------------
155- 166 (22.30/16.46) LPAAEAARKWRP
174- 185 (22.74/ 6.37) LPASQPSTQPKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.64| 18| 18| 212| 229| 2
---------------------------------------------------------------------------
212- 229 (32.25/23.25) FID..RVAEESFMIHLRYGG
231- 250 (28.39/19.58) YIDenPITGKPGEFHLSSTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.76| 17| 17| 278| 294| 3
---------------------------------------------------------------------------
278- 294 (28.04/15.67) LDDKKDGRADKTPKSAT
298- 314 (27.72/15.42) LKRKKSKMSPSVTPAAT
---------------------------------------------------------------------------
|