<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28726

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMESRISPTEALRGSIRYWNDFISKCLTKRLDAGPFEDYVKLVFAKHQLTPDIIADFFLQPQKSNCVSPDPRIPPYISVLTQLRYVDAASILRALYRYSSLHSLIPQQAQEQGKELGQDQEQDEGGIQLDGETKKDGTQPSQTRWKSSSWLEEVMFYHVIRLVVEGTALKDSRTALELMHIISKWMSLFSAASNSMAADMLAGGLQDPQVRHEMEVSRAAFVPLLLRLVDNPALVKAISHPAGKEPRKNFSESLTSFVQIFQPVPQFVEKLEIFRTEVLAPLDPVDKNNQAANAAMDELLDSTVGLDSLVISDLPITNTRAGLYIYLGASLVGRPLIDDHALFSYLNNRYQGNTQQSAIDLILASFDLLANAVFRNEGPRDAHLLRSFLINKVPLILGQICPPGFATSAEFCITEALSQVDTSVFPTASLMFDESRNNNPYTESVREEFCSACALHGLIEREHVERILGESSMSYEPSQEKYSKEKLVQSCLSDPDKIQALIRDMDKMDGNVGAVCQALVELLRQLCNSKETMSLKILCSQLVQKPQSLDVLLLFEKLPTVLEPICQLLDGWRYDEDQGEYQPVYEEFGAILLLVLAFAYRYGLSPADIGILSADSNVAKIIGRAHISLNLDQLTEQEHGHLGGWIHGLFDSDAGGLGDDLMSSCPPAEFYLLIATLFENIVIAYSQGSLTDDALRSGIEYLVDTFLLPSLIPAIRFLSEYLWVEQREQKSIIKILQLILLPTSISGEASTMLTAVKGIVAKPLEHSLRAYQRQDPKNQDIEPLLRALKDSLPTSRRTGAAEHQELETWATSSSSGLSGATKHLIQALVQWCIHPEMTAMPTSYTHRQIIATLKIVGASRLLRVMLEEIRQQMLTGSGSVVYDVVTALVCAPNVSNDLPPTSGLLDEAGNMPPPLQRRLTLREVLKMEAEDYRKLHKKDAELAEIVVRLYRRVEAQMVLPPPPMLQAADMQLDLAGDAASLVGDSMAAAAGVPGDGTLSIDGVGGLDMGIGGVTSDLGLGAAGSNGGLDASAEADLFGSLDTDMDVFDGWGGMDLGGP
Length1057
PositionTail
OrganismHypocrea virens (strain Gv29-8 / FGSC 10586) (Gliocladium virens) (Trichoderma virens)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
Aromaticity0.07
Grand average of hydropathy-0.063
Instability index44.57
Isoelectric point4.84
Molecular weight116104.35
Publications
PubMed=21501500

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28726
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      98.31|      32|      35|     975|    1009|       1
---------------------------------------------------------------------------
  975- 1009 (52.53/40.37)	GDAASLVGdsmAAAAGVPG..DGTLSIDGVGGLD..MGI
 1010- 1045 (45.78/26.85)	GGVTSDLG...LGAAGSNGglDASAEADLFGSLDtdMDV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     142.22|      45|      48|     477|     523|       2
---------------------------------------------------------------------------
  477-  523 (66.15/47.55)	SQEKYSKEKLVQSCLSDPDKIQALIRdMDKMDGNVGAVCQaLVELLR
  528-  572 (76.07/45.88)	SKETMSLKILCSQLVQKPQSLDVLLL.FEKLPTVLEPICQ.LLDGWR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.10|      10|      31|     654|     663|       3
---------------------------------------------------------------------------
  654-  663 (18.25/ 9.49)	GGLGDDLMSS
  687-  696 (16.84/ 8.18)	GSLTDDALRS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.08|      10|      34|     802|     811|       9
---------------------------------------------------------------------------
  802-  811 (18.84/11.68)	HQELETWATS
  833-  842 (19.24/12.08)	HPEMTAMPTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.16|      18|      72|     207|     238|      13
---------------------------------------------------------------------------
  207-  224 (30.94/39.90)	P...QVRHEMEVSRAAFVPLL
  240-  260 (26.23/ 6.64)	PagkEPRKNFSESLTSFVQIF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28726 with Med5 domain of Kingdom Fungi
Unable to open file!