Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MEEQQEPHSLASTFPNPPDFWKEFTPERIAEIAELRRAQAADGQSQDADNVRIPNLPEHLMALQPPPEPADGRWRVFGDQYMLDDRLPTLEDQGIENLPATASSSAKDAKHYDRAFELKRLTKSLLLNFLELVGTMTRNAADAEAKVADVRTILINIHHILNEYRPHQARESAIEMMQDHLDRTRTETAAIRTQVDKARKVLEGLGSLDLSAIQKIGEMEDNGARIARAQADAGDFVAACEAWMQMHRQM |
Length | 250 |
Position | Middle |
Organism | Hypocrea virens (strain Gv29-8 / FGSC 10586) (Gliocladium virens) (Trichoderma virens) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.604 |
Instability index | 51.92 |
Isoelectric point | 5.08 |
Molecular weight | 28203.42 |
Publications | PubMed=21501500 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP28724 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 73.32| 20| 97| 39| 84| 1 --------------------------------------------------------------------------- 15- 36 (34.04/30.62) PNPPDFWKEFTPEriAEIAELR 54- 73 (39.28/28.78) PNLPEHLMALQPP..PEPADGR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 45.72| 14| 32| 97| 110| 3 --------------------------------------------------------------------------- 97- 110 (22.50/16.37) NLPATASSSAKDAK 131- 144 (23.22/17.11) ELVGTMTRNAADAE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PPDFWKEFTPERIAEIAELRRAQAA 2) WRVFGDQYM | 17 74 | 41 82 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab