<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28724
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MEEQQEPHSLASTFPNPPDFWKEFTPERIAEIAELRRAQAADGQSQDADNVRIPNLPEHLMALQPPPEPADGRWRVFGDQYMLDDRLPTLEDQGIENLPATASSSAKDAKHYDRAFELKRLTKSLLLNFLELVGTMTRNAADAEAKVADVRTILINIHHILNEYRPHQARESAIEMMQDHLDRTRTETAAIRTQVDKARKVLEGLGSLDLSAIQKIGEMEDNGARIARAQADAGDFVAACEAWMQMHRQM |
| Length | 250 |
| Position | Middle |
| Organism | Hypocrea virens (strain Gv29-8 / FGSC 10586) (Gliocladium virens) (Trichoderma virens) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.604 |
| Instability index | 51.92 |
| Isoelectric point | 5.08 |
| Molecular weight | 28203.42 |
| Publications | PubMed=21501500
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28724
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.32| 20| 97| 39| 84| 1
---------------------------------------------------------------------------
15- 36 (34.04/30.62) PNPPDFWKEFTPEriAEIAELR
54- 73 (39.28/28.78) PNLPEHLMALQPP..PEPADGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.72| 14| 32| 97| 110| 3
---------------------------------------------------------------------------
97- 110 (22.50/16.37) NLPATASSSAKDAK
131- 144 (23.22/17.11) ELVGTMTRNAADAE
---------------------------------------------------------------------------
|