<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28722
Description |
Mediator of RNA polymerase II transcription subunit 22 |
Sequence | MSNQGLYGKLDQTCDVLSTKLIELVKLSSIDGPEGDGSDAALSEASIATTGVMLVNSQTMQLIKRVQDLFILTRSIREKWLLNQIPERSTQQGVGPAELEQLLDQCMQQIAGDTDVELNRPLG |
Length | 123 |
Position | Head |
Organism | Torulaspora delbrueckii (strain ATCC 10662 / CBS 1146 / NBRC 0425 / NCYC 2629 / NRRL Y-866) (Yeast) (Candida colliculosa) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Torulaspora.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.193 |
Instability index | 39.67 |
Isoelectric point | 4.41 |
Molecular weight | 13431.15 |
Publications | PubMed=22123960
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 PIRNR:PIRNR007936
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP28722
No repeats found
No repeats found
|