<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28714
| Description |
Uncharacterized protein |
| Sequence | MSGISDLLVPDMKLEELETSLATGGDDPKDRVDKAITDAQNSILPMRLQFNDFMHTMSNIDDLQNSTPMEKFNLIRSKVLDLSDKLQTMSEDVGKLHPLFDTIPEYSEKYGTKKFQPLETLRIPQSNSVSSPQTQNNAIVGANLNKKANRSNDGTPVSQTSTPMGSAVPTPYATTAKKPRKPRQPKKPQTPAAAAAAAAVAANGHIKSQASPTPPAHMVSSVPATNPVQMVNSVPPTNMMGTPMQNLMSPLGNTPNYGFSQQQSQQQPTPQQQQRQQYNSATKNSTMPQSQPMNLNSITPANILSMSMTGDPLHQQQQQNKKEFDPLDFNNLDFGNLNMDMI |
| Length | 342 |
| Position | Tail |
| Organism | Torulaspora delbrueckii (strain ATCC 10662 / CBS 1146 / NBRC 0425 / NCYC 2629 / NRRL Y-866) (Yeast) (Candida colliculosa) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Torulaspora.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.733 |
| Instability index | 55.27 |
| Isoelectric point | 6.98 |
| Molecular weight | 37404.74 |
| Publications | PubMed=22123960
|
Function
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | RNA polymerase II activating transcription factor binding GO:0001102 IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP28714
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 216.88| 54| 55| 209| 263| 1
---------------------------------------------------------------------------
123- 178 (39.44/12.46) ......................IPQSNSV....SSPQTQNNaivganlnkkanrsndGTPVSQTSTPMGSavpTP.YATTAKK
209- 263 (101.06/44.95) QASPTP.........PAHMVSSVPATNPVQMvNSVPPTNMM................GTPMQNLMSPLGN...TPNYGFSQQQ
265- 319 (76.37/30.23) QQQPTPqqqqrqqynSATKNSTMPQSQPMNL.NSITPANIL................S......MSMTGD....PLHQ.QQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.75| 16| 16| 84| 99| 2
---------------------------------------------------------------------------
84- 99 (28.99/20.05) DKLQTMSEDVG..KLHPL
101- 118 (25.76/17.06) DTIPEYSEKYGtkKFQPL
---------------------------------------------------------------------------
|