Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSAAIDEQTLPSYYYYVDPEVTYQASRPNPLEDLISAYGLQDLSHQVARANSDGSKAIKLRKSYKNQISELSGKFGTIPTRENGKGGEVAHILFQNNPDMMNQVRKESGMTPEEYHTAMINRDASLFEPPNLDWNMCRSVLSQFERSYPTEFQNQPGFQVEDLAFDLDGTGKVNAKKRKVKSNGSSMATPNSDMQEDVKRRRLE |
Length | 204 |
Position | Head |
Organism | Torulaspora delbrueckii (strain ATCC 10662 / CBS 1146 / NBRC 0425 / NCYC 2629 / NRRL Y-866) (Yeast) (Candida colliculosa) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Torulaspora. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.853 |
Instability index | 43.51 |
Isoelectric point | 5.72 |
Molecular weight | 23081.46 |
Publications | PubMed=22123960 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi transcription open complex formation at RNA polymerase II promoter GO:0001113 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP28707 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 99.15| 29| 30| 93| 122| 1 --------------------------------------------------------------------------- 93- 122 (48.69/27.62) LFQnNPDM.MNQVRKESGMTPEEYHTAMINR 126- 155 (50.46/24.92) LFE.PPNLdWNMCRSVLSQFERSYPTEFQNQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 83.14| 26| 35| 26| 56| 2 --------------------------------------------------------------------------- 26- 56 (38.10/33.78) SRPNPLEDLISAYGLQDlshqvARANSDGSK 63- 88 (45.03/27.79) SYKNQISELSGKFGTIP.....TRENGKGGE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LPSYYYYVDPEVTY 2) TPNSDMQEDVKRRRL | 10 189 | 23 203 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab