<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28707
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSAAIDEQTLPSYYYYVDPEVTYQASRPNPLEDLISAYGLQDLSHQVARANSDGSKAIKLRKSYKNQISELSGKFGTIPTRENGKGGEVAHILFQNNPDMMNQVRKESGMTPEEYHTAMINRDASLFEPPNLDWNMCRSVLSQFERSYPTEFQNQPGFQVEDLAFDLDGTGKVNAKKRKVKSNGSSMATPNSDMQEDVKRRRLE |
| Length | 204 |
| Position | Head |
| Organism | Torulaspora delbrueckii (strain ATCC 10662 / CBS 1146 / NBRC 0425 / NCYC 2629 / NRRL Y-866) (Yeast) (Candida colliculosa) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Torulaspora.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.853 |
| Instability index | 43.51 |
| Isoelectric point | 5.72 |
| Molecular weight | 23081.46 |
| Publications | PubMed=22123960
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
transcription open complex formation at RNA polymerase II promoter GO:0001113 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP28707
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 99.15| 29| 30| 93| 122| 1
---------------------------------------------------------------------------
93- 122 (48.69/27.62) LFQnNPDM.MNQVRKESGMTPEEYHTAMINR
126- 155 (50.46/24.92) LFE.PPNLdWNMCRSVLSQFERSYPTEFQNQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.14| 26| 35| 26| 56| 2
---------------------------------------------------------------------------
26- 56 (38.10/33.78) SRPNPLEDLISAYGLQDlshqvARANSDGSK
63- 88 (45.03/27.79) SYKNQISELSGKFGTIP.....TRENGKGGE
---------------------------------------------------------------------------
|