Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MLNRQSKKYNKPETEMQPQYVQDRLESLAEVDNKLCSLLKTASQIVFTFSELKQGNHELKPQFEQHVKQFYTDLESSTVQLRQEIKLLDENVGTRLLPINVNKKATGQDDDKMREQVAILKDILGENN |
Length | 128 |
Position | Head |
Organism | Torulaspora delbrueckii (strain ATCC 10662 / CBS 1146 / NBRC 0425 / NCYC 2629 / NRRL Y-866) (Yeast) (Candida colliculosa) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Torulaspora. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.824 |
Instability index | 45.04 |
Isoelectric point | 5.73 |
Molecular weight | 14864.68 |
Publications | PubMed=22123960 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP28700 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.60| 23| 47| 4| 27| 1 --------------------------------------------------------------------------- 4- 27 (37.43/28.13) RQSKKYNKPETEMQ.PQYVQDrLES 53- 76 (38.17/23.80) KQGNHELKPQFEQHvKQFYTD.LES --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LRQEIKLL 2) REQVAILKDILGEN | 81 114 | 88 127 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab