<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28696
| Description |
Piso0_001398 protein |
| Sequence | MSADYWSSSQRMKWQFNRQTLLDYRRKLLILERKMIQSGLIKDYQYVNYDWNMRIYLHNVIVKLGRRLNIRQVVLATAEVYLTRFLTKVSVKEVNVYLLVAACVYASCKIEECPQHIRLILSEARSLWPEYIPHDTAKLAEFEFYLLEEMNLYLILHHPYRSLLQIQTFLKENYDTYAFVLTDDELQNSWSLISDSYITDLHLLYPPHIIAITVIYITIVLKKNSSSLKSNGNSIDADVNEKPQSGSIESQNDPSAMEIEDLMTLSSSNPQEEPLAQPVPGATQLEVKSLSKIDQDTIRINKFMKFLNHSHINLDEVAESIQDMVNLYVVWNHYNENLVKKSLHRMLTNS |
| Length | 350 |
| Position | Kinase |
| Organism | Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) (Hybrid yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Millerozyma.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.233 |
| Instability index | 53.68 |
| Isoelectric point | 6.01 |
| Molecular weight | 40887.47 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28696
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.62| 12| 18| 222| 239| 1
---------------------------------------------------------------------------
222- 233 (19.64/22.08) KKNSSSLKSNGN
242- 253 (20.98/ 7.11) KPQSGSIESQND
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.68| 18| 21| 64| 81| 2
---------------------------------------------------------------------------
64- 81 (29.74/19.33) LGR...RLNIRQV...VLATAEVY
82- 105 (18.93/10.24) LTRfltKVSVKEVnvyLLVAACVY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.06| 14| 21| 311| 324| 3
---------------------------------------------------------------------------
311- 324 (23.90/17.63) HINLDEVAESIQDM
333- 346 (25.16/18.94) HYNENLVKKSLHRM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.32| 20| 21| 134| 153| 4
---------------------------------------------------------------------------
134- 153 (34.09/21.55) HDTAK.LAEFEFYLLEEMNLY
157- 177 (32.23/20.03) HHPYRsLLQIQTFLKENYDTY
---------------------------------------------------------------------------
|